Activin is part of the TGF-beta superfamily, known to regulate growth and differentiation of cells. The β-C subunit of Activin is expressed in a range of tissues having growth promoting and inhibitory properties. β-C Clone 1 recognizes the β-C subunit of Activin and is a useful stain to detect expression of the protein in hepatocyte cells.
| Catalogue No. | Target | Research Areas | Applications | Size | Price (£) |
|---|---|---|---|---|---|
| BetaC1-100UG | Follistatin (FS288) |
Endocrinology Cancer Immunology Hepatology |
WB IHC |
0.1mg | 347.00 |
Form in stock: IgG, purified – 1.0 mg/mL. Also available as unpurified supernatant.
Host: Mouse
Specificity: Synthetic peptide sequence VPTARRPLSLLYYDRDSNIKVTDIPMVVEAC which recognizes amino acids 82-113 of human Activin β -C subunit.
Human Histology positive control: Liver
Fusion partner: Spleen cells immunised from immunised Balb/c mice were fused with cells of the mouse SP2/0 myeloma cell line.
Storage: Store at +4°C or -20°C. Avoid repeated freezing and thawing.
Shelf life: 18 months from date of dispatch.
Regulatory/ Restrictions: For research and commercial purposes.
- ⇓ Sally L. Mellor, Mark Cranfield, Rainer Ries, John Pedersen, Belinda Cancilla, David de Kretser, Nigel P. Groome, Anthony J. Mason, Gail P. Risbridger; Localization of Activin βA-,β B-, andβ C-Subunits in Human Prostate and Evidence for Formation of New Activin Heterodimers ofβ C-Subunit. J Clin Endocrinol Metab 2000; 85 (12): 4851-4858.
- ⇓ Sally L. Mellor, Emma M. A. Ball, Anne E. O’Connor, Jean-François Ethier, Mark Cranfield, Jacqueline F. Schmitt, David J. Phillips, Nigel P. Groome, Gail P. Risbridger; Activin βC-Subunit Heterodimers Provide a New Mechanism of Regulating Activin Levels in the Prostate. Endocrinology 2003; 144 (10): 4410-4419. WB, Dilution used 1:5000
- ⇓ Gold, E. J. “Beta A- and Beta C-activin, Follistatin, Activin Receptor MRNA and Beta C-activin Peptide Expression during Rat Liver Regeneration.” Journal of Molecular Endocrinology 34.2 (2005): 505-15. WB, Dilution 1:3000
Western Blot used to determine whether Beta C Clone 1 recognizes mono- and dimeric active Beta C
(Mellor S, L et al. 2000)
Dilution used: 1:5000
Beta C Clone 1 used to detect hepatocytes in human liver by IHC
β C-Subunit immunoreactivity was detected in hepatocytes in human liver sections with βC clone 1 antibody supernatant … (Mellor S, L et al. 2000)
Dilution used: 5.8 μg/mL
Beta C Clone 1 used to detect hepatocytes in human liver by IHC
C) Cytoplasmic βC-activin subunit immunoreactivity in association with mitosis. (D) βC-activin subunit immunoreactivity within hepatocyte nuclei… (Gold, E. J)
Dilution used: 5.0 μg/mL