SARS-CoV-2 Nucleocapsid Protein

£630.00

1 mg

SKU: BSV-COV-PR-53

Nucleocapsid recombinant protein of SARS-CoV-2 (COVID-19) expressed in E. coli. Contains 6x His-tag located at the N terminal.

Predicted Molecular Mass: The SARS-CoV-2 (COVID19) Recombinant Protein (N) predicts a molecular mass at 46 kDa.

2019 nCoV Amino Acids: 1-419 aa (Accession No.YP_009724397)

Sequence: MHHHHHHGSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALT
QHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNA
AIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAE
ASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVIL
LNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA

Purity: 95 % by SDS-PAGE
Homogeneity: >95% by SDS-PAGE densitometry
Endotoxin: Endotoxin level is < 0.1 ng/μg of protein (<1 EU/μg)
Expressed Host: E. Coli
Tag: His-tag
Species: 2019-nCoV
Predicted Molecular Weight: SARS-CoV-2 Nucleocapsid Protein predicts a molecular mass at 46 kDa
Concentration: 5 mg/ml
Formulation: Frozen liquid in PBS
Shipping: Shipped on Dry Ice
Storage: -80 °C. Avoid repeated freeze-thaw
Regulatory/Restrictions: For Research Use Only

Mass Spectrometry by electron ionisation determined as 46507.29 M+H+ ion