1. Home
  2. Recombinant Proteins and Antibody Research Tools
  3. SARS-CoV-2 Recombinant Proteins
  4. SARS-CoV-2 Nucleocapsid Protein

SARS-CoV-2 Nucleocapsid Protein

£600.00

1 mg

SKU: BSV-COV-PR-53

Nucleocapsid recombinant protein of SARS-CoV-2 (COVID-19) expressed in E. coli. Contains 6x His-tag located at the N terminal.

Predicted Molecular Mass: The SARS-CoV-2 (COVID19) Recombinant Protein (N) predicts a molecular mass at 46 kDa.

2019 nCoV Amino Acids: 1-419 aa (Accession No.YP_009724397)

Sequence: MHHHHHHGSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALT
QHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNA
AIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAE
ASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVIL
LNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA

Menu